PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 183aa    MW: 20213.7 Da    PI: 8.3659
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101342.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.33.5e-4510108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++C+++pyfp e+p+kfanvhk+FGasnv+kll+++p+++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+
  XP_011101342.1  10 PCAACKFLRRKCTPGCIFSPYFPPEEPQKFANVHKIFGASNVSKLLHDIPPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQVDRLQKELD 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_011101342.1 105 AANA 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.6829110IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CTPGCIFSPY FPPEEPQKFA NVHKIFGASN VSKLLHDIPP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIT FLQRQVDRLQ KELDAANADL IRYACNGGLH  120
QPSTNPMVVP PPRQRPIVEH NRRIANDGGS GFYQTPSSFS FPYYNSPWND HYGPHGGGFG  180
GSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101342.11e-136PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML42e-68LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A068UWU91e-86A0A068UWU9_COFCA; Uncharacterized protein
STRINGPOPTR_0015s09370.12e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.45e-70LBD family protein